PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00493g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 523aa    MW: 59283.7 Da    PI: 6.1687
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00493g00012.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2231.4e-681555172374
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                               ++lL  cA a++ g+++++q+lL  l+elas + d+++Rlaa+ ++AL ++l+          ++ +        +l +l  f++
  Niben101Scf00493g00012.1 155 EHLLNPCAAAITVGNMNRVQHLLYVLHELASFTCDANHRLAAHGLRALTHHLSF---------RAHPL-------HLDSLINFND 223
                               699*************************************************97.........33333.......3444556*** PP

                      GRAS  87 vsPilkfshltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeel 158
                               + P++++ + +aN+ +l+ + ++   + +Hi+D+++s+G+QWp+Ll++L+ R+ ++pp +RiT++ +  ++              
  Niben101Scf00493g00012.1 224 INPWFRIPNNIANSSVLQILGEQdklKSLHILDIGVSHGVQWPTLLEELTRRSgGPPPLVRITVITPTIENaelrgtpfvIGPPG 308
                               ********************999566667************************55666*******99665577888888877788 PP

                      GRAS 159 eetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
                                +  ++L  fA+++++++++n l    l++l+ + ++ + +E+l+++ +++lh+l+   ++ ++er+e+L+++k+l Pk vv++e
  Niben101Scf00493g00012.1 309 YNFSSQLLAFAKAININLQINRLDNFLLQNLNSQVINSSADETLVICAQFRLHNLH---HCNPDERTELLRVLKNLDPKGVVLSE 390
                               9999******************866699***************************9...88888999****************** PP

                      GRAS 244 qe..adhns.esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFk 325
                               ++  +++ns ++F++ f++ +e+ + ++ds+++ +    + r + Er++++ e+ +++++ g++    +e++ekW er++++GF 
  Niben101Scf00493g00012.1 391 NNieCSCNScGDFATTFSRRVECLWRFLDSTSVAY----KGRESEERRMMEGEAAKALTNTGEM----NERKEKWCERMRSVGFV 467
                               *93355555269*******************9885....77888888888888*********99....88888************ PP

                      GRAS 326 pvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +  ++e+a + a++llrk++ +++ rvee++g++ l Wk++p+ ++S W+
  Niben101Scf00493g00012.1 468 KEVFGEDAIDGARSLLRKYDsNWEIRVEERDGCVDLWWKGQPISFCSLWK 517
                               ********************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.881128496IPR005202Transcription factor GRAS
PfamPF035144.9E-66155517IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MTIDEPEPNS NSDPISDWLA TLSDVPTFLD EPYNYPEDLD FYGDSWWIPP NQDKDIVNHD  60
IIDNNICTSF NYSSPVNTAT STIPPEPIIL DHPQPLDLSK KRKTSGSDHN PKVSRKNQNR  120
QINDADEIKK STGQKRVTNK STTNNGNNKE GRWAEHLLNP CAAAITVGNM NRVQHLLYVL  180
HELASFTCDA NHRLAAHGLR ALTHHLSFRA HPLHLDSLIN FNDINPWFRI PNNIANSSVL  240
QILGEQDKLK SLHILDIGVS HGVQWPTLLE ELTRRSGGPP PLVRITVITP TIENAELRGT  300
PFVIGPPGYN FSSQLLAFAK AININLQINR LDNFLLQNLN SQVINSSADE TLVICAQFRL  360
HNLHHCNPDE RTELLRVLKN LDPKGVVLSE NNIECSCNSC GDFATTFSRR VECLWRFLDS  420
TSVAYKGRES EERRMMEGEA AKALTNTGEM NERKEKWCER MRSVGFVKEV FGEDAIDGAR  480
SLLRKYDSNW EIRVEERDGC VDLWWKGQPI SFCSLWKIDS QCK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-2515151784473Protein SHORT-ROOT
5b3h_B1e-2515151730419Protein SHORT-ROOT
5b3h_E1e-2515151730419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019255393.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A1J6IFR20.0A0A1J6IFR2_NICAT; Nodulation-signaling pathway 1 protein
STRINGXP_009600029.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-139GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]