PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00491g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 214aa    MW: 24098.1 Da    PI: 8.9447
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00491g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM116.82.1e-3671121115
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrFhPtdeel+++yL++kv++ ++++ +++++vd++k++        + +e+ewyfFs rd+ky+tg r+nrat++gyWk+
  Niben101Scf00491g00001.1   7 LPPGFRFHPTDEELITCYLRNKVSDFSFTA-TAFSDVDLNKSKA-------SMGEEEWYFFSLRDRKYPTGLRTNRATEAGYWKT 83 
                               79*************************999.88******99863.......33789***************************** PP

                       NAM  86 tgkdkevlskkgelvglkktLvfykgrapk 115
                               tgkdk +++ +g ++g+k+tLvfy+grapk
  Niben101Scf00491g00001.1  84 TGKDKGIFQ-GGVAIGMKRTLVFYRGRAPK 112
                               *********.******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-413112IPR003441NAC domain
PROSITE profilePS5100535.2967150IPR003441NAC domain
PfamPF023651.3E-218111IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MAEINNLPPG FRFHPTDEEL ITCYLRNKVS DFSFTATAFS DVDLNKSKAS MGEEEWYFFS  60
LRDRKYPTGL RTNRATEAGY WKTTGKDKGI FQGGVAIGMK RTLVFYRGRA PKVCRVFQKR  120
STMKKAQPTS SSQQSRECPN CDTNCTISNE IIGDSELPKL ISIDTPSNYG INNISLHNYN  180
NENMNMNFSA VTRSEGASNI NVPFVPNWSN LPSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-34611216129NO APICAL MERISTEM PROTEIN
1ut4_B1e-34611216129NO APICAL MERISTEM PROTEIN
1ut7_A1e-34611216129NO APICAL MERISTEM PROTEIN
1ut7_B1e-34611216129NO APICAL MERISTEM PROTEIN
3swm_A1e-34611219132NAC domain-containing protein 19
3swm_B1e-34611219132NAC domain-containing protein 19
3swm_C1e-34611219132NAC domain-containing protein 19
3swm_D1e-34611219132NAC domain-containing protein 19
3swp_A1e-34611219132NAC domain-containing protein 19
3swp_B1e-34611219132NAC domain-containing protein 19
3swp_C1e-34611219132NAC domain-containing protein 19
3swp_D1e-34611219132NAC domain-containing protein 19
4dul_A1e-34611216129NAC domain-containing protein 19
4dul_B1e-34611216129NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767002.11e-129PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ26e-53NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1U7VG001e-128A0A1U7VG00_NICSY; NAC domain-containing protein 100
STRINGXP_009767002.11e-128(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.17e-64NAC domain containing protein 58
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]