PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00360g05007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 318aa    MW: 36204.8 Da    PI: 6.0895
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00360g05007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix28.73.5e-091885269
                  trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegek 69
                              Wt +e l+L++  ++++ + +++ +  ++W++  +++ + g++rs +qCk++we +   y k+k +e 
  Niben101Scf00360g05007.1 18 WTLHESLTLVNEMKSTQIECGNTLASFQKWQSTVQNCISLGVNRSLNQCKKRWEFMLENYNKVKPWET 85
                              ****************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.5E-71784No hitNo description
PROSITE profilePS500906.4111874IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEKSGGSLRT RSQVAPDWTL HESLTLVNEM KSTQIECGNT LASFQKWQST VQNCISLGVN  60
RSLNQCKKRW EFMLENYNKV KPWETAYWTT SFDGDRKSEL GLPENFDFEL FSAIGRYLSL  120
LQGEDGGGAE TDPDSDPDAQ QAQGNNSLLE IGLKRQRRRT KPRKYKMEER LNPWRRILNE  180
NRKYEQSMVG IKHEASVDAK LEAPSHEKSS LQIKRETSNL EEKVEVPSLS LVNMVKAEQI  240
NVDNPEEMMA ATLRENAELI TAIINGTPMD DRDCRLADLK NFEAGRVHLI RSQGNQLIEC  300
LGKIADTLSQ LCDSIHKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019226701.10.0PREDICTED: trihelix transcription factor ASR3
TrEMBLA0A314KRR80.0A0A314KRR8_NICAT; Uncharacterized protein
STRINGXP_009603649.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA83602124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.12e-42sequence-specific DNA binding transcription factors