PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00304g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 899aa    MW: 101513 Da    PI: 6.7311
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00304g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR126.32.5e-0844864890
                      FAR1 48 tekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                              +++  +++++   +C+a+l+v+++ ++kw+vtk  +eH+H+l+
  Niben101Scf00304g06001.1 44 QDEVVEPQTVYGESCDAMLRVELKGQNKWVVTKYMKEHSHSLV 86
                              3456778888899****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.5E-64486IPR004330FAR1 DNA binding domain
PfamPF105511.2E-26224315IPR018289MULE transposase domain
PfamPF044342.4E-9502536IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096611.189502538IPR007527Zinc finger, SWIM-type
SMARTSM005751.8E-6513540IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 899 aa     Download sequence    Send to blast
MDVEGIDVEQ GSMQHQGGIT DDGDDEPSES GEANVNGRSN APEQDEVVEP QTVYGESCDA  60
MLRVELKGQN KWVVTKYMKE HSHSLVHPNK VHYHTSHRHF AVAKKNGPEN NQGVGIVPSG  120
VMYVSVDGNR IPLEINRGAK STRPAESDQT IKDTVPQSFS PRQCNQRRTL GRDAQNLLNY  180
FKKMQAENPG FYYAIQLDEE NRMANVFWAD ARSRNAYSHF GDAVILDTMY RVNQCRVPFA  240
PFTGVNHHGQ TILFGCALLL DESEATFIWL FKTFLAGMND RAPVSIITDQ DTVIQSAVAQ  300
VFPGTRHCIN KWHVLRGGQD RMAHVCHMYP NFQVELYNCI NLTETVEEFE SYWETILEKY  360
DLKKNDWLKS IYNARQQWVP AYFRDTFFAA LSPNKEYECS FFDGYVNQQI TLPLFFRQYE  420
RALENSFEKE IEADFDTICT TPPLRTPSPM EKQAATLYTK KIFLKFQEEL VETFVYTANR  480
IDGDGALSTF RVAKFEDDQK AYIVSLNISE LKANCSCQMF ECSGILCRHI LTVFTVTNVL  540
TLPSHYILKR WTINAKCAAE SDEHVQLHGT ESIAQKYNSL CREAIRYAEE GAVAQETYKA  600
ALAALKEGGK KVALAKRNVA KVSPPSSQVS GVGYDDRRTS ASAPEMTPLL WPRQDEMTKR  660
FNLNDTGISA RTIADLNAQR MAPXGISART IADLNGQRMA PVSLHRDDGH ADNKVILPCL  720
KSMTWVMENK TSTPANRVAV INLKLQDYSR TPSRESEVKF QLSRVTLEPM LKSMAYISEQ  780
LSTPANRVAV INLKLLSCKE TSASAMNCLT DIESISFQLQ DTETTSGESE VKFQVSRDTL  840
AAMLRSMAYI REQLSNTVLL PPYLGGASTR PSFVSSKFAF SNYLRTWLCF KVFAHFKVQ
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776133.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 3 isoform X3
SwissprotQ9ZVC90.0FRS3_ARATH; Protein FAR1-RELATED SEQUENCE 3
TrEMBLA0A1U7WBW60.0A0A1U7WBW6_NICSY; protein FAR1-RELATED SEQUENCE 3 isoform X3
STRINGXP_009776131.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27110.20.0FAR1-related sequence 3
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]