PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00262g02008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 115aa    MW: 12622.3 Da    PI: 4.146
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00262g02008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26031.64.6e-101376197
                    DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelall 97
                              +vyeA ar+rdPvyG+vg+i++lq+++  l++ l+++
  Niben101Scf00262g02008.1  1 MVYEATARLRDPVYGCVGIISALQKHVFDLQSVLNEA 37
                              69*************************9999887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.4E-8136IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MVYEATARLR DPVYGCVGII SALQKHVFDL QSVLNEALAE AMSLRTQLSD ALSLPSLLEG  60
SPFTPENHEF LHFQKPSEQN AYTDASDALL LLPEAAGNHC PQDSEVLLPL PYLDI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016445883.16e-68PREDICTED: LOB domain-containing protein 3-like
TrEMBLA0A1S3Y0Z41e-66A0A1S3Y0Z4_TOBAC; LOB domain-containing protein 3-like
STRINGXP_009631247.12e-67(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA131471419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-12LOB domain-containing protein 1