PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00192g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 207aa    MW: 23429.6 Da    PI: 8.5471
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00192g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.99.5e-3511105195
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCa+Ck++r+kCa+ C+lapyfpae++k+f++vhk+FG+snv kl+k+l ee+r++a++slv+eA +r++dPv G++g ++++ +
  Niben101Scf00192g00001.1  11 ACASCKHQRKKCANTCILAPYFPAEKSKEFQAVHKIFGVSNVAKLIKTLIEEDRKKAADSLVWEAFCRQKDPVLGSYGEYRRVIE 95 
                               7**********************************************************************************99 PP

                    DUF260  86 qleqlkaela 95 
                               +l+  k++ +
  Niben101Scf00192g00001.1  96 ELKLYKSQHQ 105
                               9999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.60310111IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-3311105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MQKINSRDTA ACASCKHQRK KCANTCILAP YFPAEKSKEF QAVHKIFGVS NVAKLIKTLI  60
EEDRKKAADS LVWEAFCRQK DPVLGSYGEY RRVIEELKLY KSQHQQILQM PSQGATGLMY  120
NAAEGRNNGY NNTKANYMME FCPCSNNIHL QHVQNNMEKL TSDSNGYTII VPQQAIDGFT  180
NHYYLTAGSC SPIDVKRMEN SLWEASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-211010910113LOB family transfactor Ramosa2.1
5ly0_B2e-211010910113LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790364.11e-134PREDICTED: LOB domain-containing protein 27-like
RefseqXP_016466095.11e-134PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A1S3ZNI01e-133A0A1S3ZNI0_TOBAC; LOB domain-containing protein 27-like
TrEMBLA0A1U7XTY21e-133A0A1U7XTY2_NICSY; LOB domain-containing protein 27-like
STRINGXP_009790364.11e-134(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-51LOB domain-containing protein 2