PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00180g10005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 283aa    MW: 32203 Da    PI: 5.3857
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00180g10005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1092.4e-343793359
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                               + lkcprC s ntkfCyynny+ sqPr++Ck C+r+Wt+GG+lrnvPvGggr++++
  Niben101Scf00180g10005.1 37 PEPLKCPRCSSINTKFCYYNNYNKSQPRHYCKDCKRHWTEGGTLRNVPVGGGRKNKR 93
                              6789***********************************************977665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.5E-313992IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-214093IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.7954094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGLSTKLVSF DDHGLDNLSQ NPLPEPPTTR RQPTPKPEPL KCPRCSSINT KFCYYNNYNK  60
SQPRHYCKDC KRHWTEGGTL RNVPVGGGRK NKRLRPTDPV DHIIRMECVT LEANDQRCPL  120
ISTTVPTSTI RGNITTLDEE KKESDIFYET LNFPSTSLPF DHTITNISKK PFNGNYNDIF  180
SGLKLDGNTH FSFCFDTVPC SLITQTSNVC NEYMGKFDNT VEESTVTTVK PITSNSDLLS  240
QPWQIPETSD VTENMSSYWN WNEIDTLNTA DLNIAWDDFE IKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780420.10.0PREDICTED: dof zinc finger protein PBF-like
TrEMBLM1C1N11e-107M1C1N1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000577821e-106(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-27OBF binding protein 4