PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00163g06010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 602aa    MW: 67483.7 Da    PI: 8.0699
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00163g06010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR195.94.7e-3062150291
                      FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHn 86 
                               fYn+YA++vGF +r+s+ ++ +r+++i +r++vCskeg++ + +++ +k rr+r ++r+gCka+l+vkk+ +gkw +tk++++Hn
  Niben101Scf00163g06010.1  62 FYNSYARRVGFGTRVSAYRRARRDNTISSRQLVCSKEGFNPRPDER-HKPRRQRIVSRVGCKAHLTVKKQASGKWAITKFVKDHN 145
                               9***************************************999998.99************************************ PP

                      FAR1  87 Helap 91 
                               Hel+p
  Niben101Scf00163g06010.1 146 HELVP 150
                               ***86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.2E-2762150IPR004330FAR1 DNA binding domain
PROSITE profilePS5096611.226285317IPR007527Zinc finger, SWIM-type
PfamPF044346.0E-10287316IPR007527Zinc finger, SWIM-type
SMARTSM005758.5E-9292319IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MESQPLNLEN DAMEFHVGSG EEEEEDYKHI SSGLDSGDQC SSSNLEPYEG MEFESEQAAR  60
IFYNSYARRV GFGTRVSAYR RARRDNTISS RQLVCSKEGF NPRPDERHKP RRQRIVSRVG  120
CKAHLTVKKQ ASGKWAITKF VKDHNHELVP PDQVHLLRSH RHVSGPARSL IDTLQAAGLG  180
ATRVMSVLIK QSGGINNYEK ATASRHEKEV KVENDTINIA PILKTPSPME KQAANVYTRE  240
VFLMFQQELM ETLAYPATVI NDTGPDIVYQ VAKFGEDHKV HYVQYSVFEK KASCSCQLFD  300
SSGIPCKHIL AVFRVKNVLR LPSHYILKRW TRKAKREIVL DEDDLGLPSS HNESFTGRFE  360
KLSLEATKYV KEGVDSENAY QVAMAALREA SKNVAAAMCS TPAPPQCLDM NKAKKFNLNG  420
NQDDCRDSCL VSFTGRFEKL SLEATKYVKE GVDSENAYQV AMAALREASK NVAAAMCSTP  480
APPQCLDMNK AKKFNLNGNQ DDCRDSCLVV AHISALPWLL KPSDAAHHFS FPPSTLPANV  540
DRPILAHHSQ DEKIQELKTA VVNATEICEA YRAKLLSILS EMEEQKLRIS LKVQSMRLNQ  600
MT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591935.11e-149PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009591996.11e-149PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A1S3ZJB91e-148A0A1S3ZJB9_TOBAC; protein FAR1-RELATED SEQUENCE 5-like
STRINGXP_009591935.11e-149(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-63FAR1-related sequence 5