PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00149g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 300aa    MW: 35455.1 Da    PI: 8.7953
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00149g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.12.6e-2449131186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               +W+ qe+++ + +r e+++++ ++k++k lWe ++ km+++g++rsp+qCk+kw+nl +ryk +++ e +     ++++p++++l
  Niben101Scf00149g03002.1  49 QWSIQETRDFLMIRAELDQTFVETKRNKLLWEVIATKMKDKGYNRSPEQCKCKWKNLVTRYKGCETLEPEA--L-RQQFPFYNEL 130
                               7********************************************************************95..3.4589*****9 PP

                  trihelix  86 e 86 
                               +
  Niben101Scf00149g03002.1 131 Q 131
                               8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.009346108IPR001005SANT/Myb domain
CDDcd122033.75E-2448113No hitNo description
PfamPF138376.1E-2049133No hitNo description
PROSITE profilePS500907.44550106IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDPHLHHHHH QNHQQQQQQQ NPFSRQSVNV DTIGGGVNIG TTSGDRFPQW SIQETRDFLM  60
IRAELDQTFV ETKRNKLLWE VIATKMKDKG YNRSPEQCKC KWKNLVTRYK GCETLEPEAL  120
RQQFPFYNEL QAIFAARMQR MLWLEAEGGG GSKKKTISQL SSDEEEENED SEGEKVVGIT  180
KKKRKVKGNN VNIVGSSSRG GSGNLLVNSF KEILDDFMKQ QMAMEMQWLK AYEAKEEERR  240
IKEMEWRQTM EALENERLMM ERRWREREEQ RRIREEARAE KRDALITALL NKLRREDHNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A8e-1346129386DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180185KKKRKV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799172.11e-167PREDICTED: trihelix transcription factor GT-3b-like
RefseqXP_016459805.11e-167PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW01e-70TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A1S3Z5Q51e-166A0A1S3Z5Q5_TOBAC; trihelix transcription factor GT-3b-like
TrEMBLA0A1U7Y4X81e-166A0A1U7Y4X8_NICSY; trihelix transcription factor GT-3b-like
STRINGXP_009799172.11e-167(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.15e-55Trihelix family protein