PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00146g03007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 148aa    MW: 17432.1 Da    PI: 10.0678
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00146g03007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM70.93.4e-22141423128
                       NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykv.ePwdLpk.kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                               +G+rFhPt+ el+ ++Lk+ ++g+ l+ e + ++ +diy    Pw++ + + ++ e k +y F++ +kk+++ +r +r+ + g+W
  Niben101Scf00146g03007.1  14 MGVRFHPTEVELI-NFLKRFLKGELLQSECHnFQLADIYGDqPPWEIFEdNSDHpEGKVCYIFTRLKKKKREHTRIRRTCAYGTW 97 
                               7************.9********9977755559999***87368***6322222356688************************* PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               k +    ++++ kg++vg ++ + f + +++  ++  W+m ey++
  Niben101Scf00146g03007.1  98 KGQTGIDPIKKGKGTVVGFRRCFKFQSRSKEGEHNKIWLMREYSV 142
                               *8888899**99*************977777777888******86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-218145IPR003441NAC domain
PROSITE profilePS5100520.53312148IPR003441NAC domain
PfamPF023651.3E-1414142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MSMVPPAARR GCIMGVRFHP TEVELINFLK RFLKGELLQS ECHNFQLADI YGDQPPWEIF  60
EDNSDHPEGK VCYIFTRLKK KKREHTRIRR TCAYGTWKGQ TGIDPIKKGK GTVVGFRRCF  120
KFQSRSKEGE HNKIWLMREY SVGDDFFR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770805.16e-89PREDICTED: protein SOMBRERO-like, partial
TrEMBLA0A1U7W9791e-87A0A1U7W979_NICSY; protein SOMBRERO-like
STRINGXP_009770805.12e-88(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8141386
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.16e-11NAC domain containing protein 2