PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00138g04001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 334aa    MW: 37923.5 Da    PI: 7.0626
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00138g04001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.5e-54111401128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgy 82 
                               +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+
  Niben101Scf00138g04001.1  11 VPPGFRFHPTDEELLYYYLTKKVSYEAIDL-DVIREVDLNKLEPWDLKEicRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGF 94 
                               69****************************.9***************954555442556************************** PP

                       NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               Wkatg+dk+++ ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  Niben101Scf00138g04001.1  95 WKATGRDKAIYLSNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 140
                               ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-606163IPR003441NAC domain
PROSITE profilePS5100557.89211163IPR003441NAC domain
PfamPF023658.5E-2812140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSGAGNGQLS VPPGFRFHPT DEELLYYYLT KKVSYEAIDL DVIREVDLNK LEPWDLKEIC  60
RIGSGPQNEW YFFSHKDKKY PTGTRTNRAT TAGFWKATGR DKAIYLSNSK RIGMRKTLVF  120
YTGRAPHGQK TDWIMHEYRL DDNTAKVEPL QEDGWVVCRV FKKKNYTRGF QHELGEDDQE  180
QQLHFVDHMK SGNSDPKQNM QQPHHQACYD YASNFDGSMH LPQLLSPDLL SVNPCPQLPL  240
GTNMNLNECS HQNLLRLTSA AGAAGCSSST FNIVPQHDKF SGDWSFLDKL LASNQGAMQS  300
QAAIGDNLVN PTGTQKYPVF HHHGFDPDLF KFSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-51816514167NO APICAL MERISTEM PROTEIN
1ut4_B3e-51816514167NO APICAL MERISTEM PROTEIN
1ut7_A3e-51816514167NO APICAL MERISTEM PROTEIN
1ut7_B3e-51816514167NO APICAL MERISTEM PROTEIN
3swm_A5e-51816517170NAC domain-containing protein 19
3swm_B5e-51816517170NAC domain-containing protein 19
3swm_C5e-51816517170NAC domain-containing protein 19
3swm_D5e-51816517170NAC domain-containing protein 19
3swp_A5e-51816517170NAC domain-containing protein 19
3swp_B5e-51816517170NAC domain-containing protein 19
3swp_C5e-51816517170NAC domain-containing protein 19
3swp_D5e-51816517170NAC domain-containing protein 19
4dul_A3e-51816514167NAC domain-containing protein 19
4dul_B3e-51816514167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019247997.10.0PREDICTED: NAC domain-containing protein 76 isoform X1
RefseqXP_019247998.10.0PREDICTED: NAC domain-containing protein 76 isoform X1
RefseqXP_019247999.10.0PREDICTED: NAC domain-containing protein 76 isoform X1
SwissprotQ9MA171e-111SMB_ARATH; Protein SOMBRERO
TrEMBLA0A1J6ICA00.0A0A1J6ICA0_NICAT; Protein sombrero
STRINGXP_009794036.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-103NAC family protein
Publications ? help Back to Top
  1. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]