PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00033g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 125aa    MW: 14401.6 Da    PI: 5.2823
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00033g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.62.3e-3412110199
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaC ++r+kCa++C lapyfp++++++f+nv +lFG+sn++++l+++++e++ ++++sl+ eA++r  +PvyG++++ +kl+ 
  Niben101Scf00033g03002.1  12 KCAACMHQRKKCAANCQLAPYFPSDRSEDFQNVYQLFGVSNIINMLDSVDDEQKGQMAESLILEAKIRKVNPVYGCLAIERKLRL 96 
                               5************************************************************************************ PP

                    DUF260  86 qleqlkaelallke 99 
                                +e++++el+ +++
  Niben101Scf00033g03002.1  97 AIEETEKELEIVQK 110
                               *********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.82911112IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-3312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MENADLLIYN EKCAACMHQR KKCAANCQLA PYFPSDRSED FQNVYQLFGV SNIINMLDSV  60
DDEQKGQMAE SLILEAKIRK VNPVYGCLAI ERKLRLAIEE TEKELEIVQK TNAFYKEMAK  120
SQMQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-20101069105LOB family transfactor Ramosa2.1
5ly0_B4e-20101069105LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019225769.16e-78PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A314KT001e-76A0A314KT00_NICAT; Lob domain-containing protein 27
STRINGXP_009629106.12e-73(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28661752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-29LOB domain-containing protein 27