PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00024g03019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 247aa    MW: 27380 Da    PI: 4.5121
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00024g03019.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260317.1e-1014458101
                    DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                               m+s++y+A+ar + PvyG+v+ i++l  +++  ++el++++++l
  Niben101Scf00024g03019.1   1 MKSIIYQANARDKHPVYGCVAEIQNLVFNIQLYEEELQAVHAQL 44 
                               89*************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.249144IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-7141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MKSIIYQANA RDKHPVYGCV AEIQNLVFNI QLYEEELQAV HAQLAFYRQQ QQHQQQEISS  60
TALSDSVSHI QLGMPPPPAV APPPPPPQAT NGNGLTLFHQ DAPSQQYNAA INANALPVQS  120
YPSYSNNSYA AYNNNTTFVD LKENNAVNSL WIQQSYGNSA CNNNTMIMQS QLPASQSISV  180
PPEVTHDYDE IHPFFDTIDD RQSYIDSKEA YDSSSESSLK DTRHSVEHVA ENELKSAAAC  240
FTLTSVN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019244725.11e-145PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A1J6J4U11e-144A0A1J6J4U1_NICAT; Lob domain-containing protein 27
STRINGXP_009777754.11e-137(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-10LOB domain-containing protein 27