PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Ctg14233g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 329aa    MW: 35833.2 Da    PI: 6.4156
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Ctg14233g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.19.1e-17240274135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Ctg14233g00001.1 240 CLHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRL 274
                               99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.0E-8215327IPR016679Transcription factor, GATA, plant
SMARTSM004012.9E-16234284IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.479234270IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-14236297No hitNo description
Gene3DG3DSA:3.30.50.106.9E-14236271IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.34E-13239286No hitNo description
PfamPF003201.2E-14240274IPR000679Zinc finger, GATA-type
PROSITE patternPS003440240265IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEASDFFVRG YFSNAGDEQN PNNNNNNNNN NNNNFTVDDL LDFSKEDEVM TDAFFDSITG  60
NSADSSTVTV VDSCNSSVSV ENGHFNGNLS CRSFTDAPFP SSELCVPYDD LAELEWLSNF  120
VEESFSSDDV QNLQLIPVTN INSAANNTTD SSSSATTISA GINSPPAFPA DTSVPGKARS  180
KRSRAAPCDW SSRLQLLLSP TTSSSESNNS AANNNTSATA KATKAPTKKR EIIETPGRKC  240
LHCASEKTPQ WRTGPMGPKT LCNACGVRYK SGRLVPEYRP AASPTFVSAK HSNSHRKVLE  300
LRRQKEFQRH PAHHHQHQLI SQTSIFGVS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628152.10.0PREDICTED: GATA transcription factor 12-like
RefseqXP_016470527.10.0PREDICTED: GATA transcription factor 12-like
TrEMBLK4BMN81e-170K4BMN8_SOLLC; Uncharacterized protein
STRINGSolyc03g120890.2.11e-170(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19192363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.13e-62GATA transcription factor 12