PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Ctg00579g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 78aa    MW: 8731.91 Da    PI: 3.9025
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Ctg00579g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26025.92.7e-0813269100
                    DUF260  69 ardPvyGavgvilklqqqleqlkaelallkee 100
                               +rdPvyG+vg i+ lq+q++ql+ +la++++e
  Niben101Ctg00579g00001.1   1 MRDPVYGCVGAISYLQNQVSQLEMQLAMAQTE 32 
                               69*************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031954.2E-6230IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MRDPVYGCVG AISYLQNQVS QLEMQLAMAQ TEILCIQMQQ ESAPNLPAIQ MEQYDGSTPQ  60
AMSFGNPNYL VAGEEFRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019240841.13e-49PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-18LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1J6JRW56e-48A0A1J6JRW5_NICAT; Lob domain-containing protein 12
STRINGXP_009784491.17e-47(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-20LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]