PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Ctg00317g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 113aa    MW: 12555.2 Da    PI: 4.4304
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Ctg00317g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26043.41e-133495096
                    DUF260 50 peeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                              p ++reda+ s+vyeA ar+rdP yG+vg+i++lq+++ +l++el++
  Niben101Ctg00317g00003.1  3 PVDNREDAVISMVYEATARLRDPAYGCVGIISALQKHVFHLQSELNE 49
                              6789****************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.476154IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-13249IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
EIPVDNREDA VISMVYEATA RLRDPAYGCV GIISALQKHV FHLQSELNEA LGSPFTPENH  60
AFLHFQKPSE QNAYADASDT LLLLPEAAGN HCPQDNQVLL PLQYWPFIQL AAI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631247.29e-55PREDICTED: LOB domain-containing protein 4-like
TrEMBLA0A1S4CR381e-51A0A1S4CR38_TOBAC; LOB domain-containing protein 25-like isoform X2
TrEMBLA0A1S4CRC51e-51A0A1S4CRC5_TOBAC; LOB domain-containing protein 25-like isoform X1
STRINGXP_009631247.14e-45(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA131471419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.14e-15LOB domain-containing protein 25