PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g468210.1
Common NameMTR_8g468210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 283aa    MW: 32194.9 Da    PI: 5.9281
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g468210.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-1877130356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Medtr8g468210.1  77 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 130
                      456899***********************************************9 PP

2HD-ZIP_I/II132.91.2e-4276166191
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                      ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr+yd++k++n++L++++++L++e+
  Medtr8g468210.1  76 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKRQYDTIKADNDALQAQNQKLQTEI 166
                      69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.14E-1971134IPR009057Homeodomain-like
PROSITE profilePS5007117.11972132IPR001356Homeobox domain
SMARTSM003891.8E-1875136IPR001356Homeobox domain
CDDcd000869.45E-1677133No hitNo description
PfamPF000461.6E-1577130IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-1979139IPR009057Homeodomain-like
PRINTSPR000311.1E-5103112IPR000047Helix-turn-helix motif
PROSITE patternPS000270107130IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5112128IPR000047Helix-turn-helix motif
PfamPF021837.9E-17132172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAFFPANFML QTSHQDEHHQ PPPSLNSIIT SCAPQDYHGG GVSFLGKRSM SFSGIELGEE  60
ANVEEELSDD GSQLGEKKRR LNMEQVKTLE KSFELGNKLE PERKMQLARA LGLQPRQIAI  120
WFQNRRARWK TKQLEKDYDV LKRQYDTIKA DNDALQAQNQ KLQTEILALK NREPTESINL  180
NKETEGSSSN RSENSSDIKL DISTRTQAID SPLSTQQTSI NLFPSSSRPA GVPHQLFQTN  240
SRQDIQCQKI DHMVKEESLS NMFCAMDDQS GLWPWLEQQH FN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124132RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.178000.0leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in leaves and flowers. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g468210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0519610.0BT051961.1 Medicago truncatula clone MTYF9_FA_FB_FC1G-H-4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013445749.10.0homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-119ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A072U1W40.0A0A072U1W4_MEDTR; Homeobox leucine zipper ATHB-like protein
STRINGXP_004511225.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-109HD-ZIP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  4. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]