PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g445680.1
Common NameMTR_8g445680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 175aa    MW: 19912 Da    PI: 5.3383
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g445680.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26040.29.7e-131178269
           DUF260  2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69
                     C  C+ ++r+C++dC + + f  +++++f+ + +  G sn++++++++++ +r+ a++s++ +++ ++
  Medtr8g445680.1 11 CLLCQCHNRHCNNDCEYGEFFKPHRNEDFQSALRSLGLSNIMSMMESVETYDRQGAANSILSQGRDWQ 78
                     999*********************************************************98887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.1469110IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-111180IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MNEGNKHARV CLLCQCHNRH CNNDCEYGEF FKPHRNEDFQ SALRSLGLSN IMSMMESVET  60
YDRQGAANSI LSQGRDWQRR QYGRQLEMGE EISSFKRKAL FASTFMTFCR YYAKSVPFPI  120
TSRSYKMNGI LTASESGESS NASKGKQVLI EQSDSEDNDD MEDLSPNENA RSEE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g445680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A072TPV31e-128A0A072TPV3_MEDTR; DUF260 family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1630089
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G36000.12e-10LOB domain-containing protein 5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]