PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g432540.1
Common NameMTR_8g432540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 811aa    MW: 88904.5 Da    PI: 5.8989
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g432540.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.6e-21116171156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Medtr8g432540.1 116 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 171
                      688999***********************************************999 PP

2START205.42.3e-643205441206
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela++a++elvk+a+ ++p+W +s     e++n +e++++f++  +     + +ea+r++g v+ ++  lve+l+d++ +W e+++    + +t
  Medtr8g432540.1 320 ELALAAMDELVKMAQTSDPLWIRSIeggrEILNHEEYMRTFTPCIGlkpngFVSEASRETGTVIINSLALVETLMDSN-RWIEMFPciiaRTST 412
                      5899**************************************99999*******************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                       evis+g      galqlm+ael +lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   s+v +++lpSg+++++++ng+skvtwve
  Medtr8g432540.1 413 NEVISNGingtrnGALQLMQAELHVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGATSFVNCRKLPSGCVVQDMPNGYSKVTWVE 506
                      *************************************************************999****************************** PP

                      -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      h++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  Medtr8g432540.1 507 HTEYEENQVHQLYRPLLSSGMGFGASRWVATLQRQCEC 544
                      ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-20101173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-21105173IPR009057Homeodomain-like
PROSITE profilePS5007117.248113173IPR001356Homeobox domain
SMARTSM003892.2E-17114177IPR001356Homeobox domain
CDDcd000863.83E-18115173No hitNo description
PfamPF000461.9E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084844.084311547IPR002913START domain
SuperFamilySSF559616.04E-34313544No hitNo description
CDDcd088752.03E-124315543No hitNo description
PfamPF018527.2E-56320544IPR002913START domain
SMARTSM002346.1E-48320544IPR002913START domain
SuperFamilySSF559617.03E-24572803No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MSFGGFVENN SGGGGGVRNI GEISYNNERM PFGSFSQPRL VTSPALAKSM FNSPGLSLAL  60
QTNIDGQEDV NGSMHGNYEQ NGLRRSREEE QSRSGSDNLD GVSGDEQDAD DKPPRKKRYH  120
RHTPQQIQEL ESLFKECPHP DEKQRLELSK RLCLETRQVK FWFQNRRTQM KTQLERHENN  180
LLRQENDKLR AENMSIRDAM RNPICSNCGG PAMIGEISLE EQHLRIDNAR LKDELDRVCA  240
LAGKFLGRPI SSLPNSSLEL GVGGNNNNGF NVMNNVPSTL PDFSSGMSNN PLAIVSPSNR  300
QTSMVTTGFD RSVERSMFLE LALAAMDELV KMAQTSDPLW IRSIEGGREI LNHEEYMRTF  360
TPCIGLKPNG FVSEASRETG TVIINSLALV ETLMDSNRWI EMFPCIIART STNEVISNGI  420
NGTRNGALQL MQAELHVLSP LVPVREVNFL RFCKQHAEGV WAVVDVSIDT IRETSGATSF  480
VNCRKLPSGC VVQDMPNGYS KVTWVEHTEY EENQVHQLYR PLLSSGMGFG ASRWVATLQR  540
QCECLAILMS SAAPSRDHSA ITAGGRRSML KLAQRMTNNF CAGVCASTVH KWNKLNPGNV  600
DEDVRVMTRK SVDDPGEPPG IVLSAATSVW LPVSPQRLFD FLRDERLRSE WDILSNGGPM  660
QEMAHIAKGQ DHGNCVSLLR ASAMNSNQSS MLILQETCID EAGSLVVYAP VDIPAMHVVM  720
NGGDSAYVAL LPSGFAIVPD GPGSRGLENG DATANGGGEA RVSGSLLTVA FQILVNSLPT  780
AKLTVESVET VNNLISCTVQ KIKAALQCES *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.148990.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g432540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013444922.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A072TNH20.0A0A072TNH2_MEDTR; Homeobox leucine zipper protein
STRINGXP_004510857.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]