PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g093920.1
Common NameMTR_8g093920, NF-YB15
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 215aa    MW: 24957.6 Da    PI: 6.5067
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g093920.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.61.3e-5639134297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdrflPianv+rimkkv+Pan+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfe+yveplk yl+kyr++eg
  Medtr8g093920.1  39 KEQDRFLPIANVGRIMKKVIPANGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEEYVEPLKCYLQKYRDIEG 132
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      ek
  Medtr8g093920.1 133 EK 134
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.6E-5432162IPR009072Histone-fold
SuperFamilySSF471132.4E-4041158IPR009072Histone-fold
PfamPF008089.6E-2844108IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.0E-217290No hitNo description
PROSITE patternPS0068507591IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.0E-2191109No hitNo description
PRINTSPR006159.0E-21110128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MDDESHSNLP NGFNTENPET HCLKTINNNN HNHHHNSNKE QDRFLPIANV GRIMKKVIPA  60
NGKISKDAKE TVQECVSEFI SFVTGEASDK CQREKRKTIN GDDIIWAITT LGFEEYVEPL  120
KCYLQKYRDI EGEKVNVPKQ QRSEQRLHQH QHQHNQDELN NQHFNNSVYT STNLMSQTPY  180
MTTDQPFPLP FSPNSIQKQL RQQDQIDSIG HWYE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-4537129294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4537129294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and green siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g093920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1523490.0AC152349.12 Medicago truncatula clone mth2-52p10, complete sequence.
GenBankJQ9182880.0JQ918288.1 Medicago truncatula nuclear transcription factor Y subunit B15 (NF-YB15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630291.11e-161nuclear transcription factor Y subunit B-3
SwissprotQ9SIT95e-72NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLG7LE451e-160G7LE45_MEDTR; Nuclear transcription factor Y protein
STRINGAET047671e-160(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132492430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.11e-70nuclear factor Y, subunit B7
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]