PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g079660.1
Common NameMTR_8g079660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 265aa    MW: 28266.8 Da    PI: 5.3051
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g079660.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.56.7e-3681071100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lr++C ++C lapyfp ++p++f  vh +FG +nv+++lk+++ +++e+a++s vyeAear+rdPvyG++g  ++lq++l++++ el
  Medtr8g079660.1   8 PCAACKHLRQECDSSCDLAPYFPPDNPERFIKVHSVFGKNNVSNMLKKVDASHHEQAIESFVYEAEARLRDPVYGCAGPAKDLQRRLNEVQMEL 101
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++k+e
  Medtr8g079660.1 102 KSVKNE 107
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.3957108IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-358105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MAREIIRPCA ACKHLRQECD SSCDLAPYFP PDNPERFIKV HSVFGKNNVS NMLKKVDASH  60
HEQAIESFVY EAEARLRDPV YGCAGPAKDL QRRLNEVQME LKSVKNELAK YLNPQIVEFV  120
LGFPDCFGFK PNASAPTMTI GAGQLAFNQL PAAELTTQQI HNLEVLKQNL LSGPDGDDGL  180
AGFHMDVNVP VENGGINTSS HPVGGGSVNG SGGSTRFQMG ADILVRDSGL AGSHMLPDVP  240
PADAPSALPS SRADTIDNGG TSNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-33811111114LOB family transfactor Ramosa2.1
5ly0_B9e-33811111114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g079660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1485250.0AC148525.14 Medicago truncatula chromosome 8 clone mth2-24i13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003629577.10.0LOB domain-containing protein 36
TrEMBLA0A396GM580.0A0A396GM58_MEDTR; Putative transcription factor AS2-LOB family
STRINGAET040530.0(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-39ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]