PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g079620.1
Common NameMTR_8g079620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 239aa    MW: 25825.4 Da    PI: 6.5937
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g079620.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.67.5e-3781071100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+l rkC   Cvlapyfp+++p++f  vh +FG++nv++llk+l+ +++e+a++slvyeA+a++rdP++G++g  ++lq +l+++++el
  Medtr8g079620.1   8 PCAACKHLHRKCHLTCVLAPYFPKDNPERFIKVHSVFGMRNVTNLLKKLDVSHHEQAVESLVYEADAWLRDPIHGCAGPANDLQGRLNEAQTEL 101
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++k+e
  Medtr8g079620.1 102 KSVKNE 107
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4247108IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-358105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MDREIIRPCA ACKHLHRKCH LTCVLAPYFP KDNPERFIKV HSVFGMRNVT NLLKKLDVSH  60
HEQAVESLVY EADAWLRDPI HGCAGPANDL QGRLNEAQTE LKSVKNELAK YLGPQVVESV  120
LAFPDCFGFK PNASPLTMTV GGGQLGFNQL PAAELTAQQL HNLEVLKQKL LSGPDGDDGL  180
AGFQMGADVD VPVRDSGLAG SQMLPHVPPV DAPSRADTFD NGSTSTSNQV RLPGSRNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-30811111114LOB family transfactor Ramosa2.1
5ly0_B3e-30811111114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g079620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1485250.0AC148525.14 Medicago truncatula chromosome 8 clone mth2-24i13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003629573.11e-178LOB domain-containing protein 28
TrEMBLG7LGC51e-176G7LGC5_MEDTR; LOB domain protein
STRINGAET040491e-177(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-37ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]