PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g079060.1
Common NameMTR_8g079060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 230aa    MW: 24221.8 Da    PI: 8.4872
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g079060.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-382585262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++++l+cprCdstntkfCyynny+ sqPr+fCkaCrryWt+GG+lr++PvGgg+rkn k+s
  Medtr8g079060.1 25 EQENLPCPRCDSTNTKFCYYNNYNYSQPRHFCKACRRYWTHGGTLRDIPVGGGTRKNAKRS 85
                     57899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-312283IPR003851Zinc finger, Dof-type
PfamPF027016.0E-332783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1522983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MTSSDSGESR RSTKPQIRPG APAPEQENLP CPRCDSTNTK FCYYNNYNYS QPRHFCKACR  60
RYWTHGGTLR DIPVGGGTRK NAKRSRTNHV AVTSSSAVTS AAPEHHHYQT ISAVQGGSFP  120
FSGGVDGDGK QNMSVCGSFT SLLNNNNNNN QSSGFLALGG FGLGLEEMGF GIGRTGWAFP  180
GMMDGVPVVS SGVVGNTWQL EGGEGGFVGA GDCFSWPGLA ISTPVNGLK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.51220.0flower| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Constitutively expressed in the whole plant. {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:8718629}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g079060.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1342640.0BT134264.1 Medicago truncatula clone JCVI-FLMt-3F20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446454.11e-170dof zinc finger protein DOF3.4
SwissprotQ390884e-56DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A072TTI51e-168A0A072TTI5_MEDTR; Dof domain zinc finger protein
STRINGXP_004509185.11e-111(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.18e-46OBF binding protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]