PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g076340.1
Common NameMTR_8g076340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 292aa    MW: 32722.7 Da    PI: 7.2239
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g076340.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-18220254135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Medtr8g076340.1 220 CSHCGVQKTPQWRTGPGGPKTLCNACGVRYKSGRL 254
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.1E-856289IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.899214250IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-14214276No hitNo description
SMARTSM004018.8E-18214268IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.4E-15218252IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.29E-14219267No hitNo description
PROSITE patternPS003440220245IPR000679Zinc finger, GATA-type
PfamPF003201.7E-16220254IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MECVKAEAAL KSSFNISTAV KLTPQNLLED LSSFNVQDIA PIDDFFVDDF LNFSNEEQEH  60
EHEQDFLVEK QQNHTPQYTT QNQNQISHPI LNNQFVSLPT TELTVPVEEA ADLEWLSYFV  120
EDSFSEFPKT ENLQLQQKAH EPNPTFSTPC FKTPVPAKAR SKRTRTGIRV WPISLANSSS  180
TSSSATLSSS NLEECSKPAE KKAKRMVSPD GEARGVPRRC SHCGVQKTPQ WRTGPGGPKT  240
LCNACGVRYK SGRLLPEYRP ACSPTFSSEL HSNHHRKVIE MRRKKEVVPG F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.231470.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743510.0AC174351.5 Medicago truncatula chromosome 8 clone mth2-7h5, complete sequence.
GenBankAC1467200.0AC146720.23 Medicago truncatula chromosome 8 clone mth2-17n5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003629365.10.0GATA type zinc finger transcription factor family protein
SwissprotQ9FH572e-67GATA5_ARATH; GATA transcription factor 5
TrEMBLG7LD100.0G7LD10_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA01G37450.12e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-66GATA transcription factor 5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]