PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g044220.1
Common NameMTR_123s0013, MTR_8g044220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 440aa    MW: 49015.9 Da    PI: 6.5079
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g044220.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1191.7e-37114173261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG +rnvP+G+g+r+nk+s
  Medtr8g044220.1 114 PDKVLPCPRCNSLETKFCYFNNYNVNQPRHFCKNCQRYWTAGGVIRNVPIGAGKRRNKQS 173
                      78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29111171IPR003851Zinc finger, Dof-type
PfamPF027013.3E-31115172IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.425118172IPR003851Zinc finger, Dof-type
PROSITE patternPS013610120156IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MFHVKEEQQE EDPSIKLFGS DIQIHTPINQ THTTDSQIHS LPHQQSIMNG LEESTNADVE  60
VSSKQVNPQE DANAIPNMYN TGTLKPVTKA VHRTNEHKTA KRDTDNQEKV FKKPDKVLPC  120
PRCNSLETKF CYFNNYNVNQ PRHFCKNCQR YWTAGGVIRN VPIGAGKRRN KQSPLQNCQV  180
PVTLDAVPVI HIDSKEEVPL SESVETVLNL KGHRKIEMDS STVKEDIENS SSSSVRAAES  240
GEMEYSESGI EHVGLTLTPQ CNGLIPLHSL HYYSAPPWTY PCWNPVAFKS DNITSSPATM  300
MTVEVPMTPS YWGCMPNWVG QMEELSLVGS AFNGIPSPSS SPTLGKHCRD GSTQEEDIMK  360
PNIWVPKTIR INDPEEAAKS SIWSTLRTKS EQNKPIMKGS VFKSFEPKSN ASSRDLDDNQ  420
ILRANPAAFS RSGSFQESV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g044220.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003628145.10.0cyclic dof factor 1
TrEMBLG8A1Q80.0G8A1Q8_MEDTR; DOF-type zinc finger DNA-binding family protein
STRINGAES853960.0(Medicago truncatula)
STRINGAET026210.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-60cycling DOF factor 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]