PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g043650.1
Common NameMTR_8g043650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 238aa    MW: 26731.5 Da    PI: 10.1847
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g043650.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.66.9e-231664149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     k+ +n+sn qvtfskRr g++KKA+EL++LC+a+va+++fs+  k++ +
  Medtr8g043650.1 16 KKMSNESNLQVTFSKRRSGLFKKASELCTLCGADVALVVFSPGEKVFSF 64
                     5689****************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-33867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.922868IPR002100Transcription factor, MADS-box
CDDcd002651.08E-35977No hitNo description
SuperFamilySSF554553.14E-28983IPR002100Transcription factor, MADS-box
PRINTSPR004049.1E-201030IPR002100Transcription factor, MADS-box
PfamPF003199.0E-251864IPR002100Transcription factor, MADS-box
PRINTSPR004049.1E-203045IPR002100Transcription factor, MADS-box
PRINTSPR004049.1E-204566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSSERKSRGR QKIEMKKMSN ESNLQVTFSK RRSGLFKKAS ELCTLCGADV ALVVFSPGEK  60
VFSFGQPNID TVIDRYLSRV PPQNNGTMQF IEAHRNANVC ELNTQLTQIN QLLDMEKKRA  120
EELSHLRKAT EAQFWWAGPV DGMNMAQLEF FKKALEETKK VVAHHADRLV IQGAPTQTFP  180
FFVGNGSSSN MPLHHQPNPS QTQMFPAQFF QNPMLQSHLF GSNNMRGGGG YGPSRFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J7e-16987179Myocyte-specific enhancer factor 2A
3p57_I7e-16987179Myocyte-specific enhancer factor 2A
3p57_D7e-16987179Myocyte-specific enhancer factor 2A
3p57_C7e-16987179Myocyte-specific enhancer factor 2A
3p57_B7e-16987179Myocyte-specific enhancer factor 2A
3p57_A7e-16987179Myocyte-specific enhancer factor 2A
3kov_J7e-16987179Myocyte-specific enhancer factor 2A
3kov_I7e-16987179Myocyte-specific enhancer factor 2A
3kov_B7e-16987179Myocyte-specific enhancer factor 2A
3kov_A7e-16987179Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1453310.0AC145331.19 Medicago truncatula clone mth2-8o7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003628107.11e-179MADS-box transcription factor family protein
SwissprotQ9FKK21e-64AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLG7L6X51e-179G7L6X5_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27330.12e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-60AGAMOUS-like 62
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]