PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g028655.1
Common NameMTR_8g028655
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 334aa    MW: 36510.2 Da    PI: 9.4027
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g028655.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.33.7e-1364108147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Medtr8g028655.1  64 RESWTDQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 108
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1658114IPR009057Homeodomain-like
PROSITE profilePS5129415.01459113IPR017930Myb domain
TIGRFAMsTIGR015572.6E-1862111IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-662114IPR009057Homeodomain-like
SMARTSM007171.4E-1063111IPR001005SANT/Myb domain
PfamPF002499.4E-1164108IPR001005SANT/Myb domain
CDDcd001675.54E-866109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MVSINPNPTP QGFYFFDPST MALPGVNNLP PPPPPPSTTA AAASTVPEDP NKKIRKPYTI  60
TKSRESWTDQ EHDKFLEALQ LFDRDWKKIE AFVGSKTVIQ IRSHAQKYFL KVQKSGTSEH  120
VPPPRPKRKA AHPYPQKAPK NAPTASPQVM GTLQPSSAFV DPTYIYSTDS SSVLGTPVTN  180
LPLSSLNFNA PPPASLPQVT TDDTGWTGSG QAVPVNCCYS SSNEKQSSKG INEGNTGKPV  240
KVMPDFAQVY RFIGSVFDPN STNQLQRLKQ MDPINVETSL LLMRNLSINL TSPEFEDHKR  300
LLSSYDPDCE KAKFANPSSK SMTVKSENAV LST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.234630.0leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g028655.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF4684810.0EF468481.1 Medicago truncatula MYB transcription factor MYB40 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013444782.10.0protein REVEILLE 5
SwissprotC0SVG51e-108RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A072TN180.0A0A072TN18_MEDTR; Myb transcription factor
STRINGAES787050.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.17e-95MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]