PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g027295.1
Common NameMTR_8g027295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 270aa    MW: 29472.5 Da    PI: 8.7568
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g027295.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.5e-392079261
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknkk 
  Medtr8g027295.1 20 PQEQINCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKKI 79
                     6899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-271578IPR003851Zinc finger, Dof-type
PfamPF027011.7E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9662478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEGLSPNSCP RQGLEKKARP QEQINCPRCN STNTKFCYYN NYSLTQPRYF CKTCRRYWTE  60
GGSLRNVPVG GGSRKNKKIP SSLANPNNSS SKIPDLNPPT LQVSHLSSQN PKIQGGQDLN  120
LAFPSMENYH HNHGMPSSYV EMHNNNESSS SALDLLRSSM ASRGMNPYAN NNNLGLPNSN  180
AIYPSGFTMQ EVKPSLGFSI DGINGNRSYD HVQVQEGGGG GGGRLLFPFG DVNVNNKQLS  240
TSGVEVEHNK DQQGNSTGYW NGMMGEGSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.83730.0root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotTISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g027295.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-66AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
GenBankDQ8572671e-66DQ857267.1 Glycine max Dof17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024629469.10.0dof zinc finger protein DOF3.7
SwissprotQ433851e-62DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A072TM780.0A0A072TM78_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGXP_004510648.11e-132(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.46e-53Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]