PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g020840.1
Common NameNSP1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GRAS
Protein Properties Length: 555aa    MW: 61826.7 Da    PI: 6.0415
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g020840.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS245.52.1e-751695482374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL  cA a++ g+l+++q+lL  l+elas +gd+++Rlaa+ ++AL ++l++s+s++ +   + +++  +     ++l  f+e sP++ f +
  Medtr8g020840.1 169 EQLLNPCAVAITGGNLNRVQHLLYVLHELASTTGDANHRLAAHGLRALTHHLSSSSSSTPSGTITFAST--EPRFFQKSLLKFYEFSPWFSFPN 260
                      689***************************************************666666555444444..34555555556************ PP

             GRAS  96 ltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg...........skeeleetgerLakfAeelg 173
                       +aN  Il+ +++e    +++Hi+D+++s+G+QWp++l+aL+ Rp ++pp +R+T+v++++s+                 +  + L  +A++l+
  Medtr8g020840.1 261 NIANASILQVLAEEpnnlRTLHILDIGVSHGVQWPTFLEALSRRPgGPPPLVRLTVVNASSSTendqnmetpfsIGPCGDTFSSGLLGYAQSLN 354
                      ************999888999************************55566********98888777665544433333455678899******* PP

             GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyy 264
                      v+++++ l  + l++l+ ++ +++++E+l+V+ +++lh+l    ++ ++er+e+Lk++++++Pk v+++e+++++   + ++F+++f++ +ey 
  Medtr8g020840.1 355 VNLQIKKLDNHPLQTLNAKSVDTSSDETLIVCAQFRLHHLN---HNNPDERSEFLKVLRGMEPKGVILSENNMECccsSCGDFATGFSRRVEYL 445
                      *******9999*****************************8...55566667********************9886334459************ PP

             GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgs 357
                      + ++ds+++ +    ++r + Er++++ e+ ++++++ ++    +e+ ekW er++eaGF    ++e+a +  ++llrk++ +++++vee+s s
  Medtr8g020840.1 446 WRFLDSTSSAF----KNRDSDERKMMEGEAAKALTNQREM----NERREKWCERMKEAGFAGEVFGEDAIDGGRALLRKYDnNWEMKVEENSTS 531
                      *******8776....6666666667777789999888777....77778********************************9999********* PP

             GRAS 358 lvlgWkdrpLvsvSaWr 374
                      + l Wk++p+ ++S W+
  Medtr8g020840.1 532 VELWWKSQPVSFCSLWK 548
                      ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.374142527IPR005202Transcription factor GRAS
PfamPF035147.2E-73169548IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009877Biological Processnodulation
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MTMEPNPTSD HILDWLEGSV SFFPSFLDDP YNNGYIHEYE IWNQNQDISN QYQIDANTNS  60
SNATNSTTNI VAASTTTSTT SLEPNSFNNI PFSDLPKKRN AEDELSLKKQ PQNQKNKRLK  120
SRPMNESDNG DAALEGTVVR KSGGNKKGAA KANGSNSNNG NNKDGRWAEQ LLNPCAVAIT  180
GGNLNRVQHL LYVLHELAST TGDANHRLAA HGLRALTHHL SSSSSSTPSG TITFASTEPR  240
FFQKSLLKFY EFSPWFSFPN NIANASILQV LAEEPNNLRT LHILDIGVSH GVQWPTFLEA  300
LSRRPGGPPP LVRLTVVNAS SSTENDQNME TPFSIGPCGD TFSSGLLGYA QSLNVNLQIK  360
KLDNHPLQTL NAKSVDTSSD ETLIVCAQFR LHHLNHNNPD ERSEFLKVLR GMEPKGVILS  420
ENNMECCCSS CGDFATGFSR RVEYLWRFLD STSSAFKNRD SDERKMMEGE AAKALTNQRE  480
MNERREKWCE RMKEAGFAGE VFGEDAIDGG RALLRKYDNN WEMKVEENST SVELWWKSQP  540
VSFCSLWKLD KQPE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-3916254881473Protein SHORT-ROOT
5b3h_B1e-3916254827419Protein SHORT-ROOT
5b3h_E1e-3916254827419Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.241710.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in epidermal and cortical root cells. {ECO:0000269|PubMed:15961669}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Function -- GeneRIF ? help Back to Top
  1. NSP1 and NSP2 are single-copy genes in legumes, which implies that both proteins fulfill dual regulatory functions to control downstream targets after rhizobium-induced signaling as well as strigolactone biosynthesis in nonsymbiotic conditions.
    [PMID: 22039214]
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g020840.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2296920.0AC229692.10 Medicago truncatula clone mth2-60b17, complete sequence.
GenBankAJ9724730.0AJ972473.1 Medicago truncatula partial NSP1 gene for Nodulation Signaling Pathway 1 protein.
GenBankAJ9724780.0AJ972478.1 Medicago truncatula NSP1 gene for Nodulation Signaling Pathway 1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003627294.20.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A396GDF60.0A0A396GDF6_MEDTR; Nodulation-signaling pathway 1 protein
STRINGAET017700.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-156GRAS family protein
Publications ? help Back to Top
  1. Smit P, et al.
    NSP1 of the GRAS protein family is essential for rhizobial Nod factor-induced transcription.
    Science, 2005. 308(5729): p. 1789-91
    [PMID:15961669]
  2. Liu W, et al.
    Strigolactone biosynthesis in Medicago truncatula and rice requires the symbiotic GRAS-type transcription factors NSP1 and NSP2.
    Plant Cell, 2011. 23(10): p. 3853-65
    [PMID:22039214]
  3. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  4. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  5. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]