PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g017090.1
Common NameMTR_8g017090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 304aa    MW: 34385.1 Da    PI: 4.9904
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g017090.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.5e-39121121101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn+ k++k l++  +++am+++++++++ra+dPv G+++ i++lq q+e  k el
  Medtr8g017090.1  12 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNINKIIKFLDPPLKDQAMRTIIFQSDMRANDPVGGCYKYIQDLQAQIEYYKLEL 105
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                      +l++++l
  Medtr8g017090.1 106 DLVHQQL 112
                      ***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.3311112IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-3612109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MNNKNNNNTT QACAACKYQR RKCAPDCILA PYFPHDRQRQ FLNAHKLFGV SNINKIIKFL  60
DPPLKDQAMR TIIFQSDMRA NDPVGGCYKY IQDLQAQIEY YKLELDLVHQ QLAIFRSQSQ  120
QQQQQIQVNY GDQGIMNSDP LLGFYNPSGS IVPGTVPAHY HYNVQEQVVP QLQEHGQEQE  180
QEQYIITEER NSSSVNTTPL QQHNNNWGAI SLSSLSLHGQ SSNASDEYDH KPILDIPCDE  240
RNELGFDSGE ILHHSDEAVL FKIDDGLIKS DGDYIQQTQV QAQDQDHDLK GAATLFTLTN  300
CTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-261311212111LOB family transfactor Ramosa2.1
5ly0_B6e-261311212111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g017090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1409150.0AC140915.6 Medicago truncatula chromosome 8 clone mth2-10l24 map 9.500cM, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003627098.10.0LOB domain-containing protein 22
TrEMBLG7LHF80.0G7LHF8_MEDTR; LOB domain protein
STRINGAET015740.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-50LOB domain-containing protein 22
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]