PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g015840.2
Common NameMTR_138s0038, MTR_8g015840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 219aa    MW: 23811.1 Da    PI: 8.0391
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g015840.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-391676262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++++lkcprC+s+ntkfCyynny+lsqPr+fCk+C+ryWtkGGalrn+PvGgg+rk  k+s
  Medtr8g015840.2 16 EQEQLKCPRCESNNTKFCYYNNYNLSQPRHFCKNCKRYWTKGGALRNIPVGGGTRKVTKRS 76
                     57899***************************************************88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-261168IPR003851Zinc finger, Dof-type
PfamPF027016.6E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7612074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MQDQTTFQPM KPNFPEQEQL KCPRCESNNT KFCYYNNYNL SQPRHFCKNC KRYWTKGGAL  60
RNIPVGGGTR KVTKRSSNSK RSTTPSSSSP SASTTSSSAA KVSASVSETD PTQIHVDPAE  120
RNFSGGSFSS LLASTERFGN LFEGLNSNGS GLKMVEMGEF GENLNCDPVV NTDLGQNQGG  180
RNGESEIFLG LQNGGSNCWN DNHGWSDLAI YTPSSTYQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g015840.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT9673183e-73CT967318.5 M.truncatula DNA sequence from clone MTH2-3P14 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024627596.11e-162dof zinc finger protein DOF1.7
SwissprotO821551e-45DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLG8A2U01e-160G8A2U0_MEDTR; Dof domain zinc finger protein
STRINGAES857781e-161(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-36DOF zinc finger protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]