PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g009730.1
Common NameMTR_8g009730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 199aa    MW: 22345.2 Da    PI: 4.7384
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g009730.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26062.21.3e-1911108299
           DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                      C  C+++rr+  +dC + +yf a+++++f++v ++ G s+++++++a+++ +r+++++sl+ e+e++  +P +G +g+ l+l  ql+++  el+
  Medtr8g009730.1  11 CLLCRHMRRRHDADCEFGQYFSANRNADFQIVIHILGLSRLIRIMRAIEPPQRQAVANSLLTEGEVWRINPDRGFLGHQLELGAQLNTSLDELD 104
                      999*************************************************************************************999998 PP

           DUF260  96 llke 99 
                       +++
  Medtr8g009730.1 105 IARK 108
                      8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.7379110IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-1811107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MVQRNRRAIV CLLCRHMRRR HDADCEFGQY FSANRNADFQ IVIHILGLSR LIRIMRAIEP  60
PQRQAVANSL LTEGEVWRIN PDRGFLGHQL ELGAQLNTSL DELDIARKLL AFCIDNANSN  120
NAPSSMPPST QIPDLNLDLW GTEHMNDMDI TEEDMQGIPC TREKGESSNA SKGMVADEKE  180
KGILNEQGAT SDEDEDRI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr8g009730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A072TMD21e-145A0A072TMD2_MEDTR; DUF260 family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1630089
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G19820.17e-14LOB domain-containing protein 9
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]