PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g446110.1
Common NameMTR_7g446110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 253aa    MW: 29883.6 Da    PI: 7.5602
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g446110.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.72.4e-16189223135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+C t+ T++WR gp g+ tLCnaCGl+y++++l
  Medtr7g446110.1 189 CSHCETKYTTQWRLGPLGKNTLCNACGLRYKSNRL 223
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.24E-12183239No hitNo description
PROSITE profilePS5011411.464183225IPR000679Zinc finger, GATA-type
SMARTSM004014.2E-11185233IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.5E-14186222IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.88E-16188236No hitNo description
PROSITE patternPS003440189214IPR000679Zinc finger, GATA-type
PfamPF003203.5E-14189223IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MAIFDFNSKS KYHEENHAEQ FHYYIPKEVL QNLETYPTFW DTMENSLQED SNYFLFCDTY  60
EKEKVKFNQL GEGNTQSFDV TNVQINQEEN IDTYLSNDFV WPNIYEREII NLEQQNLKVP  120
FLDVSNIHAI NQENLPKEKL DTIIHKENMK EEQYGKGNTQ KPLQRTKVKS NSIKKNRDKI  180
IDIYKERSCS HCETKYTTQW RLGPLGKNTL CNACGLRYKS NRLVKGYRPV ASPSFDFNKH  240
SNFHKILLRK EG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013448362.10.0GATA type zinc finger transcription factor family protein
TrEMBLA0A072TY390.0A0A072TY39_MEDTR; GATA type zinc finger transcription factor family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1898726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.14e-24GATA transcription factor 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]