PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g446070.1
Common NameMTR_7g446070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 197aa    MW: 22679.3 Da    PI: 8.5839
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g446070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.51.8e-18134168135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      Cs+C t++T++WR+gp g+ +LCnaCGl+y+++gl
  Medtr7g446070.1 134 CSHCETKETTQWREGPLGKNSLCNACGLRYKLNGL 168
                      ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.0E-18128182IPR000679Zinc finger, GATA-type
PROSITE profilePS5011413.613128183IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.9E-16131170IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.95E-13131171No hitNo description
CDDcd002021.64E-17133185No hitNo description
PfamPF003202.9E-16134168IPR000679Zinc finger, GATA-type
PROSITE patternPS003440134159IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MANLREEQDF SEHQVDQYSQ SSSLGKLDYI PQEALENLEW YTTFWDDMEK LEKVLKFDES  60
MGEGNTQENR SFNVSSVQIN QQDNIDTSVP NHHQRICSDS ETKETTQKPL RRTKVKSCSI  120
KKSRAKKFIG DRSCSHCETK ETTQWREGPL GKNSLCNACG LRYKLNGLVK GYRPKASPAF  180
DIRNHSNLHK KAMRKE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013448359.11e-147GATA type zinc finger transcription factor family protein
TrEMBLA0A072TZ111e-147A0A072TZ11_MEDTR; GATA type zinc finger transcription factor family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1898726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-23GATA transcription factor 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]