PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g118330.1
Common NameMTR_7g118330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 755aa    MW: 82620 Da    PI: 6.3971
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g118330.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152670147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Medtr7g118330.1 26 RERWTEDEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 70
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-162076IPR009057Homeodomain-like
PROSITE profilePS5129420.5012175IPR017930Myb domain
TIGRFAMsTIGR015577.1E-172473IPR006447Myb domain, plants
SMARTSM007172.3E-122573IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-82666IPR009057Homeodomain-like
PfamPF002498.2E-132669IPR001005SANT/Myb domain
CDDcd001674.96E-92871No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MDAAAYSSGE DVVLKTRKPY TITKQRERWT EDEHNRFLEA LKLYGRAWQR IEEHIGTKTA  60
VQIRSHAQKF FSKLEKEALV KGAALGQALD IDIPPPRPKR KPSNPYPRKT NVGTPTLHSG  120
AKYGKPLIAI ASSHGKQAMD FEKESLLEEH KDEERPTTVK ENNDENCLKV LTILKEAPCS  180
SVSSAIKSSI SMSVPQTNSC TIRGFTPSVK EVITRDETNE SFPTTEIENQ MLKIDDGKHT  240
QKNDGICRTS KLENCSPKSV QSEKTDGLTS ALTIDEMQSN QNYPRHITVH VVDGNFGTST  300
QSPSQNMLIQ DSTFQPIGGI NVQPNLFANP AASNTSENQN NMARSSSHQS FPPCPPFAHN  360
HADYQSFLNM SSTFSSLIVS TLLQHPAAHA AASFAATFWP YANVESSADS PACSQGGFPS  420
RQIGSPPSVT AIAAATVAAA TAWWAAHGLL PVCAPLQTAF ACPPASTTVA PSTNISKEPP  480
KTDQGDITLH NPPLQDQLLD PENSEALQAQ HSGSKSPAVS SSESEESGDA KLNTSSKATI  540
NLDINQPISE NPDSNKMEGR KLIDRSSCGS NTTSSCEETD ALEKDEKEKE ECKIPDADHL  600
ATDPSSRRYR SISNLLDSWK EVSEEGRLAF RALFSREVLP QSFSPPHDLI NKDNQMDNMK  660
DNEQKTDHKD HLESKKCICN CDQAQQNLPF VQNNNEEGFL TMGLGQGKLK TRRTGFKPYK  720
RCLVEAKENR GGTACNQVEE TGPKRIRLEG GTSI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.40520.0leaf| pod| root| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g118330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1504430.0AC150443.2 Medicago truncatula chromosome 7 clone mth2-71o19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626618.20.0protein LHY isoform X1
RefseqXP_024627073.10.0protein LHY isoform X1
TrEMBLG7L5580.0G7L558_MEDTR; Late elongated hypocotyl-like protein
STRINGAES828360.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-106MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]