PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g115530.7
Common NameMTR_7g115530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 275aa    MW: 30042.3 Da    PI: 4.9445
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g115530.7genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-31218269152
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                      kpr+rW+peLHe+Fveav+qLGGsekAtPk +l+lm+v+gLt++hvkSHLQk
  Medtr7g115530.7 218 KPRMRWSPELHEAFVEAVNQLGGSEKATPKGVLNLMNVEGLTIYHVKSHLQK 269
                      79*************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.049215274IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-29216269IPR009057Homeodomain-like
SuperFamilySSF466893.4E-16216270IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-23218271IPR006447Myb domain, plants
PfamPF002491.2E-9220271IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MPSSSSPVLP SLMESNYMKP PDSFNCSPVR SLTANPASLQ ATSSYPIRSV RPVFSTNAEC  60
PGGVPFPPVS QHDRQYQDSP FTSQALGDNV SSEIHSATFT SHLQENDDIS WGPDPLPDIL  120
GFPDIFSVQH DQVENSACYM NEDNVKKTDF GEWVEQLMTS DDSVNPNWSQ LLGDDNVVEP  180
TQKAMHVSQK QHTSSGEVNN LCNPASASAS ASTASQTKPR MRWSPELHEA FVEAVNQLGG  240
SEKATPKGVL NLMNVEGLTI YHVKSHLQKL LRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-27218274157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-27218274157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-27218274157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-27218274157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-27218274258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.121790.0leaf| pod| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g115530.7
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013450552.10.0protein PHR1-LIKE 1
RefseqXP_024626375.10.0protein PHR1-LIKE 1
TrEMBLA0A072U4B00.0A0A072U4B0_MEDTR; Myb-like transcription factor family protein
STRINGXP_004494732.11e-147(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.45e-40G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]