PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g114600.1
Common NameMTR_7g114600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GeBP
Protein Properties Length: 442aa    MW: 49407.7 Da    PI: 4.6348
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g114600.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573121.93.1e-38109205197
           DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                      klfqrlw++eDe+ lLqG++d+++++g+s ++d+ +fy+++k++++++++k+qlveKirrLKkK+++ v+k++sgke++f+++hdq +fe+s+k
  Medtr7g114600.1 109 KLFQRLWTDEDEMELLQGFLDYTTQRGSSHHNDTAQFYDQIKSKLQLDFNKNQLVEKIRRLKKKYRNVVSKMSSGKEFVFKTAHDQATFEISRK 202
                      579******************************************************************************************* PP

           DUF573  95 iWg 97 
                      iW+
  Medtr7g114600.1 203 IWN 205
                      **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.7E-35111205IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MASQQHDTVF PEEDIDDEED EFHEYEEEDE EDDDVLVDDE ENDLPSASAS ISVPSVTVAV  60
PGGALRPPIL TPTATTIIFA DSTFSSDSKR QRLDQIEEKK PLLVEDSRKL FQRLWTDEDE  120
MELLQGFLDY TTQRGSSHHN DTAQFYDQIK SKLQLDFNKN QLVEKIRRLK KKYRNVVSKM  180
SSGKEFVFKT AHDQATFEIS RKIWNNVAPI AGDIAIDDDE INLNPISNPN LNFTPVILKS  240
EVNSTTRKRS RPRSVSIRSF EKRESNDAVA SNRDRDYLNI NLNNPNPNPY PNHNHHPNPN  300
PNAYTTTATV NPAITPTITT PNVNTNAAIH ANNYSNNCST AGNGVAGVIE ETVRSCLSPF  360
KELMAGAMGG GLFASRGSFA MNPLPFQMMN LGFGGGELAD EKWRKQQILE LEVYSKRLEL  420
VQDQIKTSLD ELRSVGGSSQ L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.126200.0flower| root| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1714980.0AC171498.6 Medicago truncatula chromosome 7 BAC clone mth2-7n16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626394.10.0DUF573 family protein
TrEMBLG7L0U10.0G7L0U1_MEDTR; DUF573 family protein
STRINGGLYMA19G43180.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.26e-54DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]