PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g098250.1
Common NameMTR_7g098250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 490aa    MW: 53857.1 Da    PI: 5.3345
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g098250.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.51.7e-34262316155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Medtr7g098250.1 262 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 316
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.837259319IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-32260318IPR009057Homeodomain-like
SuperFamilySSF466893.4E-18260316IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-25262316IPR006447Myb domain, plants
PfamPF002494.6E-10264315IPR001005SANT/Myb domain
PfamPF143798.4E-26347394IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MEARPAFSIE RSSSQQLNNI GMSGALPSSL SVHPTPLEET YPRFSDSQPT YVEKDLKTKT  60
FNHSSHISSS GAVGHMFSSS PGYSTDLHHS SLSPHEKHSR SAHFISQSLS NMASVPLPYS  120
SNNGPVPSTT STHYSNGNSA SWHADPLPSF LDFSANASID NNQVESGACN IMATEEFSKR  180
NDWQEWADQL ISDDDTLTSN WNDLLADNIQ DLEPKAVESI SKSSSQFPAG HQSQDHQQLP  240
ALSGENHVGV APSSSANSAT TKPRMRWTPE LHEAFVEAVN QLGGSERATP KGVLKLMKVE  300
GLTIYHVKSH LQKYRTARYR PESSEGAGEK KLSPIEDISS LDLKTGIEIT EALRLQMEVQ  360
KRLHEQLEIQ RNLQLRIEEQ GRYLQMMFEK QCKSGVEPFK ASSSAIENPS GVSSDTMKDS  420
PTKNELEASK MDHCKSGPDQ ANGSTTVEES SLEAVEKLDT SKSQQASKDL EQNENEDSPQ  480
APKRQRTDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-32262320260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.128580.0leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g098250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1354860.0BT135486.1 Medicago truncatula clone JCVI-FLMt-21A2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625354.10.0protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLG7KXD80.0G7KXD8_MEDTR; Myb-like transcription factor family protein
STRINGAES815720.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-112phosphate starvation response 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]