PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g093430.1
Common NameMTR_7g093430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 297aa    MW: 33152.2 Da    PI: 7.3088
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g093430.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-17159213256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Le+ F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Medtr7g093430.1 159 RKKLRLSKEQSAFLEDSFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 213
                      778899***********************************************98 PP

2HD-ZIP_I/II127.94.2e-41159249192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlskeq+++LE+sF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Medtr7g093430.1 159 RKKLRLSKEQSAFLEDSFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKSKQTEVDCEYLKRCCETLTEENKRLQKELQELR-ALK 249
                      69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-18149217IPR009057Homeodomain-like
PROSITE profilePS5007117.232155215IPR001356Homeobox domain
SMARTSM003895.3E-16157219IPR001356Homeobox domain
CDDcd000861.65E-15159216No hitNo description
PfamPF000464.3E-15159213IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-17159213IPR009057Homeodomain-like
PROSITE patternPS000270190213IPR017970Homeobox, conserved site
SMARTSM003401.8E-25215258IPR003106Leucine zipper, homeobox-associated
PfamPF021831.3E-10215249IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MELALSLGDT PKAFSLFENP TKLPNKSFCI PLEEHGLAEK SLDQKIDSSD PRPPIQLNLL  60
PSTPVLRSQP SPLLRIPWLN SAIGVEPARV SDVNQFRLAS VEDTTDEGAA VSSPNSAASY  120
YQMDFSIMNG NGDAEARNSS REEGADRNTS DDEENGSTRK KLRLSKEQSA FLEDSFKEHT  180
TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKSKQTEVD CEYLKRCCET LTEENKRLQK  240
ELQELRALKT SQPFYMQLPA TTLTMCPSCE RVATNTTGTT TTKQTTSITT GGHRQQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157163TRKKLRL
2207215RRARTKSKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g093430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1430661e-140BT143066.1 Medicago truncatula clone JCVI-FLMt-13B2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625279.10.0homeobox-leucine zipper protein HOX11
SwissprotP466652e-83HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLG7KVF50.0G7KVF5_MEDTR; Homeobox associated leucine zipper protein
STRINGAES814970.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-71homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]