PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g093030.1
Common NameMTR_7g093030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 388aa    MW: 43651.8 Da    PI: 7.1544
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g093030.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.8e-32212266155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWt++LHe+Fve+v++LGG+ekAtPk+il++m+ +gLt+ hvkSHLQkYR+
  Medtr7g093030.1 212 KTRIRWTKDLHEKFVECVNRLGGAEKATPKAILKMMDSEGLTIFHVKSHLQKYRT 266
                      68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.02E-16210266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-28210267IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-23212267IPR006447Myb domain, plants
PfamPF002496.5E-9216265IPR001005SANT/Myb domain
PfamPF143792.3E-19296343IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MSQIWNIGAC NQQQLSIVEE GESTKSCNTN TIMSRFESPA SAFYATENCM GFAEFDHQVD  60
NNQSLSSQSY KVNDLEFPLC QSLRENNHLL DASNQHDPNF ELSNTLQALV KSQLNGNQHL  120
RFPENLNKFS CGNFPFEQQK LFFDGLASVS NSSSFCNKGN HDYMVARGSY HLSVEQLNFS  180
SQHEKLSPTI SAGSLSTSLG STSSSGNVVS SKTRIRWTKD LHEKFVECVN RLGGAEKATP  240
KAILKMMDSE GLTIFHVKSH LQKYRTAKFM PESAQGKSDK RIHIDDVQHV GVKTGFQIKE  300
ALQLQLDAQR RLHEQLEIQR TLQLRLEEQG RQLKKMFDQQ QKTCSNLFNT PNTINDDTKN  360
IGKDVEVSIS ERAENSLLQS KSSERII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-24212269259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.93770.0flower| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g093030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625245.10.0myb family transcription factor PHL5
SwissprotQ0WVU35e-68PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLG7KVC10.0G7KVC1_MEDTR; Myb-like transcription factor family protein
STRINGAES814630.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.22e-42G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]