PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g088070.1
Common NameMTR_7g088070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 280aa    MW: 30294.6 Da    PI: 6.1073
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g088070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.6e-3350104155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Medtr7g088070.1  50 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 104
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0647107IPR017930Myb domain
TIGRFAMsTIGR015574.5E-2650105IPR006447Myb domain, plants
SuperFamilySSF466893.94E-1750104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-3250105IPR009057Homeodomain-like
PfamPF002491.4E-752103IPR001005SANT/Myb domain
PfamPF143796.6E-24139184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MYHAKKFPEE TMMLHKSQGG GGGGGEQFAN GGGLNGSAVK NVQPAGGGGK QRLRWTSDLH  60
DRFVDAITQL GGPDRATPKG VLRVMGVPGL TIYHVKSHLQ KYRLAKYLPE SPGDGKDSKD  120
EKRNSGDSIS GADSSPGLQI NDALRMQMEV QKRLHEQLEV QKQLQMRIEA QGKYLQKIIE  180
EQQKLGSTLA ASETLPLSHD KQNQPLSEPS GSSDALADTF SPHKKQRIDE GSKDGTAPQV  240
TIKTAQKNDC NVGPLDPNLY EDDAGYGFDL ETENDDGNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-2449107159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.123600.0leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g088070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1491340.0AC149134.2 Medicago truncatula clone mth2-19l15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003624829.20.0myb family transcription factor PHL7 isoform X1
SwissprotQ9SJW01e-71PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLG7L3R30.0G7L3R3_MEDTR; Myb-like transcription factor family protein
STRINGAES810470.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-74G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]