PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g086780.1
Common NameMTR_7g086780, MtrDRAFT_AC157472g17v2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 423aa    MW: 46386.7 Da    PI: 6.9845
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g086780.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.5e-3995154261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+++cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  Medtr7g086780.1  95 PDKIVQCPRCNSWDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPIGAGRRKNKHL 154
                      7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2983152IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3197153IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.07199153IPR003851Zinc finger, Dof-type
PROSITE patternPS013610101137IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MSETQKDHGI MLFGWKIPVP ECRIPPNSGP MDTCSSTRKT EAEIPCAEKT EQQDNSSDSM  60
DSKQESIQEK EPIVNSKPTE DNTETTDQDK LLKKPDKIVQ CPRCNSWDTK FCYFNNYNVN  120
QPRHFCKNCQ RYWTAGGTMR NVPIGAGRRK NKHLASQYRQ IIVTTNGIPT TRLESTNSSD  180
HHHTSTDNET VLKFGPDTPL CESMESMLHL RDQKRNADAN SNSSVQHRED PSLCGSSVTN  240
TGNQGNEVSE HNASNWLQCY PVSPWVLPMN PGWNNVASMA AVHPTSASMQ WCPTPMLAIP  300
GIRPQNIPLQ LVAASHWSGP SLCLSPPSST SNSCCSGNGS PTLGKHSRDT VFVDEDKTDK  360
CVPVRKTIRT DVTDAVSKSP IRATLATKKP NEEGKDGVLG GSQILEASSG AISHAHTIQE  420
SI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g086780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1379860.0AC137986.27 Medicago truncatula clone mth2-7g6, complete sequence.
GenBankAC1574720.0AC157472.3 Medicago truncatula chromosome 7 clone mth2-41h16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003624725.30.0cyclic dof factor 1
TrEMBLA0A396H9C40.0A0A396H9C4_MEDTR; Putative transcription factor C2C2-Dof family
STRINGAES809430.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-47cycling DOF factor 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]