PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g076080.1
Common NameMTR_7g076080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 779aa    MW: 85731.5 Da    PI: 6.6691
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g076080.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.6e-2192147156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Medtr7g076080.1  92 KKRYHRHTPQQIQELESMFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 147
                      688999***********************************************999 PP

2START2046.1e-642915171206
                      HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                      ela++a++elvk+a+ +ep+W +s+    e+ n +e+++++++           + +ea+r+sgvv+ ++  lve+l+d++ +W+e+++    +
  Medtr7g076080.1 291 ELALAAMDELVKMAQTNEPLWIRSVesgkEIFNHEEYTRIIST--PciglkpngFVSEASRESGVVIINSLALVETLMDSN-RWSEMFPcviaR 381
                      5899*********************999988899999999955..3458999999**************************.************ PP

                      EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEE CS
            START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskv 164
                       +t+evissg      galqlm+aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   + +  +++lpSg+++++++ng+skv
  Medtr7g076080.1 382 SSTTEVISSGingtrnGALQLMQAELQVLSPLVPvREVSFLRFCKQHAEGVWAVVDVSIDTIRETSAgAPTFLTCRRLPSGCVVQDMPNGYSKV 475
                      ****************************************************************9999************************** PP

                      EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      twveh++++++++h+l+r+l++ g+ +ga++wvatlqrqce+
  Medtr7g076080.1 476 TWVEHAEYEESQVHQLYRPLLSLGMGFGAQRWVATLQRQCEC 517
                      ****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-2175149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-2284149IPR009057Homeodomain-like
PROSITE profilePS5007117.29789149IPR001356Homeobox domain
SMARTSM003899.5E-1890153IPR001356Homeobox domain
CDDcd000861.74E-1891149No hitNo description
PfamPF000462.0E-1892147IPR001356Homeobox domain
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PROSITE profilePS5084845.284282520IPR002913START domain
SuperFamilySSF559615.33E-35283517No hitNo description
CDDcd088758.15E-120286516No hitNo description
PfamPF018525.0E-56291517IPR002913START domain
SMARTSM002345.0E-50291517IPR002913START domain
SuperFamilySSF559613.35E-23539762No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MPSSAISQPR LSTPTLVKSM FNSSGLSLAL QTNLEAQGGD MKRLMAENFH QTNNGLRRNR  60
EEEEHESCRS GSDNMDGISG DDFDAADNPP RKKRYHRHTP QQIQELESMF KECPHPDEKQ  120
RLELSKRLCL ETRQVKFWFQ NRRTQMKTQL ERHENSLLRQ ANDKLRAENM SIREAMRNPM  180
CSNCGGPAII SEISLEEQHL RIENARLKDE LDRVCTLAGK FLGRPITSLP NSSLEIGFVG  240
LNNTLPSTMP LGQDFGMVSM SPPSITRGTS MVTNTNSNGF DRSMERSMFL ELALAAMDEL  300
VKMAQTNEPL WIRSVESGKE IFNHEEYTRI ISTPCIGLKP NGFVSEASRE SGVVIINSLA  360
LVETLMDSNR WSEMFPCVIA RSSTTEVISS GINGTRNGAL QLMQAELQVL SPLVPVREVS  420
FLRFCKQHAE GVWAVVDVSI DTIRETSAGA PTFLTCRRLP SGCVVQDMPN GYSKVTWVEH  480
AEYEESQVHQ LYRPLLSLGM GFGAQRWVAT LQRQCECLAI LMSSSLPSRE HSAISAGGRR  540
SMLKLAHRMT NNFCAGVCAS TVHKWNKLNA GNVGEDVRVM TRKSVDDPGE PPGIVLSAAT  600
SVWLPASPQK VFDFLRNEKL RSEWDILSNG GPMQEMAHIA KGHDHGNCVS LLRASAINSS  660
QSSMLILQET STDASGSLVV YAPVDIPAMH VVMNGGDSAY VALLPSGFAV LPDGHSNGSG  720
NHEDASQPRV SGSLLTVAFQ ILVNSLPTAK LTVESVETVN NLISCTIQKI KVALQCES*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g076080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1487640.0AC148764.16 Medicago truncatula clone mth2-30o12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003623826.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLG7L2F00.0G7L2F0_MEDTR; Homeobox leucine zipper protein
STRINGAES800440.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]