PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g069660.1
Common NameMTR_7g069660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 353aa    MW: 40077.7 Da    PI: 5.4599
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g069660.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.8e-3172125255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH rF++av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Medtr7g069660.1  72 PRLRWTPDLHFRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 125
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.17968128IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2868126IPR009057Homeodomain-like
SuperFamilySSF466892.33E-1472126IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2272127IPR006447Myb domain, plants
PfamPF002495.8E-973124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MNMREEEAYG SECSKASISI NEDGCEISEG NEDEESNKQN INNGGISSSN STIEENCEKK  60
SSVRPYVRSK FPRLRWTPDL HFRFLHAVQR LGGQERATPK LVLQLMNIKG LSIAHVKSHL  120
QMYRSKKVVD TNQVLADHRL LVDNGDRNVY NLTQLPMLQG YTPNQTSSYR CGSYGDASLA  180
MYENMVQMSS ISDSRADFYG KMIERTNNNI INIQGHSIFQ MDSSNFRELS TTKVHEPNDN  240
FLSFCGHESL RDDLQVQPRA QDLISNDNLP ANQVEELKTM KRKASDMDLE LDLSLKLNSR  300
NDHKCIEEHE IDSNLSLSLY SQSSYVCKRM KEEQDGSKEQ EKGVNISLDL TI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-1873127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-1873127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-1873127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-1873127357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1873127458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g069660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1465540.0AC146554.5 Medicago truncatula clone mth2-9l7, complete sequence.
GenBankCT9673020.0CT967302.9 M.truncatula DNA sequence from clone MTH2-146M13 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003623331.20.0putative Myb family transcription factor At1g14600
TrEMBLG7KSC80.0G7KSC8_MEDTR; MYB-like transcription factor family protein
STRINGAES795490.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-54G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]