PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g068770.1
Common NameMTR_7g068770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Trihelix
Protein Properties Length: 294aa    MW: 35338.7 Da    PI: 7.1171
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g068770.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.91.8e-2552134186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      +W+ qe+++ + +r+e+++++ ++k++k+lWe +s+ m+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Medtr7g068770.1  52 QWSIQETKEFLMIRSELDQTFMETKRNKQLWEVISNTMKEKGYHRSAEQCKCKWKNLVTRYKGCETMEVEA---MRQQFPFYNELQ 134
                      7********************************************************************85...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122036.09E-2251116No hitNo description
PfamPF138373.6E-2152136No hitNo description
PROSITE profilePS500907.30653109IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEGHHLQHHQ QHQHQQHQQH HQQHQQRQHQ QHAHNIIGTS SVNVDVTDRF PQWSIQETKE  60
FLMIRSELDQ TFMETKRNKQ LWEVISNTMK EKGYHRSAEQ CKCKWKNLVT RYKGCETMEV  120
EAMRQQFPFY NELQAIFSAR MQRMLWAEAE GGSKKKGVHV SSEDEEELGN EESEGDHKGN  180
IKKKKKKGKM IIGGGGNDNN GSNNLKEILE EFMRQQMQME AQWMEAFEAR ENERRLKEME  240
WRQRMEALEN ERIMMEQRWR EREEQRRIRE EARAEKRDEL ITALLDKLTR EDM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.185570.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150378e-62AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013449157.10.0trihelix transcription factor GT-3a, putative
SwissprotO804501e-74TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A072U0820.0A0A072U082_MEDTR; Trihelix transcription factor GT-3a, putative
STRINGGLYMA18G43190.21e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-53Trihelix family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]