PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g061270.1
Common NameMTR_7g061270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 167aa    MW: 18331.6 Da    PI: 7.5064
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g061270.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB187.41.1e-5825121298
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre+eg
  Medtr7g061270.1  25 REQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYREMEG 118
                      89******************************************************************************************** PP

            NF-YB  96 ekk 98 
                      ++k
  Medtr7g061270.1 119 DTK 121
                      975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-5521135IPR009072Histone-fold
SuperFamilySSF471132.17E-4127132IPR009072Histone-fold
PfamPF008081.9E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-207795No hitNo description
PRINTSPR006151.4E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MSETPASPGG GSHESGEHSP RSNIREQDRF LPIANISRIM KKALPANGKI AKDAKETVQE  60
CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKIYL TRYREMEGDT  120
KGSAKGGDTS GKKDVQQGSN PQLVHQGSFS QGVSYTNSQV TLLSKML
3D Structure ? help Back to Top