PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g028905.1
Common NameMTR_7g028905
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 118aa    MW: 13461.4 Da    PI: 9.0302
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g028905.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.45.5e-3951051101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk +rr+C++dC+++pyfp ++p++f  vh+++G snv k+l++lp+  r++a++s++ eA++r++dPvyG+vg+i+kl+qq++ +++el
  Medtr7g028905.1   5 RCAACKSQRRRCPPDCIFSPYFPPNDPQRFSSVHRIYGGSNVGKMLQQLPHYVRHQAANSMYLEAQCRVQDPVYGCVGIISKLSQQIQDTEVEL 98 
                      6********************************************************************************************* PP

           DUF260  95 allkeel 101
                      a++k+++
  Medtr7g028905.1  99 AKIKTQI 105
                      **99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.6034105IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-395102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MIYSRCAACK SQRRRCPPDC IFSPYFPPND PQRFSSVHRI YGGSNVGKML QQLPHYVRHQ  60
AANSMYLEAQ CRVQDPVYGC VGIISKLSQQ IQDTEVELAK IKTQIAYHKL HNQQFDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-35610512111LOB family transfactor Ramosa2.1
5ly0_B8e-35610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g028905.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU1798943e-53CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013447968.11e-83LOB domain-containing protein 24
SwissprotP594685e-47LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A072U8203e-82A0A072U820_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGAET005252e-68(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-49LOB domain-containing protein 24
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]