PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g028448.1
Common NameMTR_4g036915, MTR_7g028448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 170aa    MW: 19885.6 Da    PI: 4.8725
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g028448.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.13e-251967149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     k+i+  snrqvtfskRr+g++KKA+EL+vLCda va+++fs+++kl+ +
  Medtr7g028448.1 19 KKIDKASNRQVTFSKRRQGLFKKASELCVLCDAHVAMVVFSPSDKLFCF 67
                     6899*****************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.0E-331170IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.2961171IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-281289IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-211333IPR002100Transcription factor, MADS-box
PfamPF003192.3E-252067IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-213348IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-214869IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MNMDNQRKKS VGHKKIEIKK IDKASNRQVT FSKRRQGLFK KASELCVLCD AHVAMVVFSP  60
SDKLFCFGQP NIDTILNSYI NETTEFEDSK TSSYEEYNRR YEEALKMLES EKKKLADVQN  120
LNKSDWWNDS IDDMSIEELE QFMESIKELK TNLNEPMLCR TMEFLDLDE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-181293181Myocyte-specific enhancer factor 2A
3kov_B2e-181293181Myocyte-specific enhancer factor 2A
3kov_I2e-181293181Myocyte-specific enhancer factor 2A
3kov_J2e-181293181Myocyte-specific enhancer factor 2A
3p57_A2e-181293181Myocyte-specific enhancer factor 2A
3p57_B2e-181293181Myocyte-specific enhancer factor 2A
3p57_C2e-181293181Myocyte-specific enhancer factor 2A
3p57_D2e-181293181Myocyte-specific enhancer factor 2A
3p57_I2e-181293181Myocyte-specific enhancer factor 2A
3p57_J2e-181293181Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013447936.11e-123MADS-box transcription factor family protein
RefseqXP_013455423.11e-123MADS-box transcription factor family protein
TrEMBLA0A072UI851e-123A0A072UI85_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27361.15e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-35AGAMOUS-like 62
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]