PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g025010.1
Common NameMTR_7g025010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family WOX
Protein Properties Length: 591aa    MW: 65674.3 Da    PI: 6.2328
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g025010.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.5e-1845105257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      ++R++++++q+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  Medtr7g025010.1  45 KPRWNPKPQQIRILEAIFNSgMVNPPREEITKIREQLqefgQVGDANVFYWFQNRKSRSKQ 105
                      89*****************99*************************************996 PP

2Wus_type_Homeobox108.44.3e-3544107265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+p+Qi+iLe++++sG+++P++eei++i+++L+e+G+++d+NVfyWFQNrk+R++qk+
    Medtr7g025010.1  44 PKPRWNPKPQQIRILEAIFNSGMVNPPREEITKIREQLQEFGQVGDANVFYWFQNRKSRSKQKK 107
                        689***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-1241108IPR009057Homeodomain-like
PROSITE profilePS5007110.81941106IPR001356Homeobox domain
SMARTSM003892.1E-743110IPR001356Homeobox domain
CDDcd000867.15E-844108No hitNo description
Gene3DG3DSA:1.10.10.606.5E-745106IPR009057Homeodomain-like
PfamPF000461.8E-1545105IPR001356Homeobox domain
Gene3DG3DSA:1.20.1130.103.0E-33414551IPR001280Photosystem I PsaA/PsaB
PfamPF002231.2E-23415495IPR001280Photosystem I PsaA/PsaB
SuperFamilySSF815583.4E-33417554IPR001280Photosystem I PsaA/PsaB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0015979Biological Processphotosynthesis
GO:0005634Cellular Componentnucleus
GO:0009522Cellular Componentphotosystem I
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MTSSNKHWPS MFKKSTNASN QRNSQGLNSS LLTGGDGEER TPEPKPRWNP KPQQIRILEA  60
IFNSGMVNPP REEITKIREQ LQEFGQVGDA NVFYWFQNRK SRSKQKKRFI HNKKRETQQN  120
SGHQTLTSPP NSSSSSSSGH QKASPDEIVI SNNIGFSNAN DGMVVFSNSP AVSVNQNQVD  180
AYFQTPTGTD LQLPTPPFFS FPVQNHINEV VPNAMTPPHR FNHLSGFMNY GSENGNSSMV  240
QPLPQQNVDV PLVNHEITMN YGSKSGIASM NHRYDQEKIQ EEAMNMIHMY QQDPQLNFGV  300
ATTSSNDDES VDLAPLPPTT IGAPDAVPFP IIDHRHQGFG VEDEAEKCMV ITKDAAFKVD  360
AGPFNVRASF GDRAVLFDSS GTPVLTDEWG VTLDSLHHGA EYYLREKLKQ DVQTRLGSLT  420
IIVCSSSYMY DMPPYTYLAA DYGTYLSLFT NNMRIGGFLI VGVDAYAAIF MVRGYDSTTQ  480
YNDLLDRVLR HHDVINIWLP RDMFSDNVVQ LQFVFVQWIQ NNYALAPGTT APGATTSTSL  540
TWGGDFVAVG YQPTLNTEMA SIRFDRSSPT TTFAHLDATA ILSRGLASKH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5l8r_A2e-48416555365529Photosystem I P700 chlorophyll a apoprotein A1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.77421e-41flower| glandular trichome| leaf| seed
Mtr.79501e-41leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g025010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF5124960.0KF512496.1 Medicago truncatula Wuschel-like homeodomain-containing protein (Wox9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024626123.10.0WUSCHEL-related homeobox 9
TrEMBLG7KXX10.0G7KXX1_MEDTR; Wuschel-related homeobox protein, putative
STRINGAES781360.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-40homeobox-3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]