PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g010950.1
Common NameMTR_7g010950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 487aa    MW: 54412 Da    PI: 6.5084
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g010950.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96.3e-40131191262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  Medtr7g010950.1 131 PDKIVPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSS 191
                      7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-31128188IPR003851Zinc finger, Dof-type
PfamPF027014.0E-32133189IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.751135189IPR003851Zinc finger, Dof-type
PROSITE patternPS013610137173IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MLETKDSAIK LFGKTIPILE VRVGDVVVES IDDDHHHFST NSSNESRNNK DEQDQEIEKN  60
TLGEKPSDEK NEDGIPIQST EEFTNPDAAS RTDEESITVS TERKAATLKT SKTEEEQDET  120
SNSQDKILKK PDKIVPCPRC NSMDTKFCYY NNYNVNQPRH FCKNCQRYWT AGGTMRNVPV  180
GAGRRKNKSS SSHYRQITVS EATLQNSRIH PSVKCNGTIL TFGSNSPVCE SMASVLKHAD  240
KTMQNYTRNG YHKHEELRIC VPHTSEEQGE DQSNKSSVTS TKSTEGATTN VSQEQAMWND  300
HSFPPQGGYF PHGTPWHLPW NPVQMSSPIP PPAFCPPGFS MPFYPATTYW GCTMPSAWNI  360
PRQAQPSSPN GANHDSTPNS PTLGKHSRED NMLKSSEGDG KKEISEEKSL WFPKTLRIDD  420
SEEAEKSSFW TTLGIKNNNA DSVPPRRLFQ AFPSKCDEKN HLVQVSSVLQ ANPAALSRSL  480
HFHETS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr7g010950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1400250.0AC140025.7 Medicago truncatula clone mth2-11i16, complete sequence.
GenBankAC2297050.0AC229705.9 Medicago truncatula clone mth2-49e17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003621247.20.0cyclic dof factor 2
TrEMBLA0A396GT850.0A0A396GT85_MEDTR; Putative transcription factor C2C2-Dof family
STRINGAES774650.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-98cycling DOF factor 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]